PDBx:entity_poly

Element Information

Model

Attributes

QName Type Fixed Default Use Inheritable Annotation
entity_id xsd:string required
This data item is a pointer to attribute id in category entity in the ENTITY category.

Source

<xsd:element name="entity_poly" minOccurs="0" maxOccurs="unbounded">
  <xsd:complexType>
    <xsd:all>
      <xsd:element name="nstd_chirality" minOccurs="0" maxOccurs="1" nillable="true">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">A flag to indicate whether the polymer contains at least one monomer unit with chirality different from that specified in attribute type in category entity_poly.</xsd:documentation>
        </xsd:annotation>
        <xsd:simpleType>
          <xsd:restriction base="xsd:string">
            <xsd:enumeration value="no"/>
            <xsd:enumeration value="n"/>
            <xsd:enumeration value="yes"/>
            <xsd:enumeration value="y"/>
          </xsd:restriction>
        </xsd:simpleType>
      </xsd:element>
      <xsd:element name="nstd_linkage" minOccurs="0" maxOccurs="1" nillable="true">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">A flag to indicate whether the polymer contains at least one monomer-to-monomer link different from that implied by attribute type in category entity_poly.</xsd:documentation>
        </xsd:annotation>
        <xsd:simpleType>
          <xsd:restriction base="xsd:string">
            <xsd:enumeration value="no"/>
            <xsd:enumeration value="n"/>
            <xsd:enumeration value="yes"/>
            <xsd:enumeration value="y"/>
          </xsd:restriction>
        </xsd:simpleType>
      </xsd:element>
      <xsd:element name="nstd_monomer" minOccurs="0" maxOccurs="1" nillable="true">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">A flag to indicate whether the polymer contains at least one monomer that is not considered standard.</xsd:documentation>
        </xsd:annotation>
        <xsd:simpleType>
          <xsd:restriction base="xsd:string">
            <xsd:enumeration value="no"/>
            <xsd:enumeration value="n"/>
            <xsd:enumeration value="yes"/>
            <xsd:enumeration value="y"/>
          </xsd:restriction>
        </xsd:simpleType>
      </xsd:element>
      <xsd:element name="number_of_monomers" minOccurs="0" maxOccurs="1" nillable="true">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">The number of monomers in the polymer.</xsd:documentation>
        </xsd:annotation>
        <xsd:simpleType>
          <xsd:restriction base="xsd:integer">
            <xsd:minInclusive value="1"/>
          </xsd:restriction>
        </xsd:simpleType>
      </xsd:element>
      <xsd:element name="pdbx_seq_one_letter_code" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">Chemical sequence expressed as string of one-letter amino acid codes. Modifications and non-standard amino acids are coded as X. A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil O for water X for other</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
      <xsd:element name="pdbx_seq_one_letter_code_can" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">Cannonical chemical sequence expressed as string of one-letter amino acid codes. Modifications are coded as the parent amino acid where possible. A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
      <xsd:element name="pdbx_seq_one_letter_code_sample" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">For cases in which the sample and model sequence differ this item contains the sample chemical sequence expressed as string of one-letter amino acid codes. Modified may be include as 'X' or with their 3-letter codes in parentheses. A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil O for water X for other</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
      <xsd:element name="pdbx_strand_id" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">The PDB strand/chain id(s) corresponding to this polymer entity. A B A,B,C</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
      <xsd:element name="pdbx_target_identifier" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">For Structural Genomics entries, the sequence's target identifier registered at the TargetTrack database. 356560</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
      <xsd:element name="type" minOccurs="0" maxOccurs="1" nillable="true">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">The type of the polymer.</xsd:documentation>
        </xsd:annotation>
        <xsd:simpleType>
          <xsd:restriction base="xsd:string">
            <xsd:enumeration value="polypeptide(D)"/>
            <xsd:enumeration value="polypeptide(L)"/>
            <xsd:enumeration value="polydeoxyribonucleotide"/>
            <xsd:enumeration value="polyribonucleotide"/>
            <xsd:enumeration value="polysaccharide(D)"/>
            <xsd:enumeration value="polysaccharide(L)"/>
            <xsd:enumeration value="polydeoxyribonucleotide/polyribonucleotide hybrid"/>
            <xsd:enumeration value="cyclic-pseudo-peptide"/>
            <xsd:enumeration value="peptide nucleic acid"/>
            <xsd:enumeration value="other"/>
          </xsd:restriction>
        </xsd:simpleType>
      </xsd:element>
      <xsd:element name="type_details" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
        <xsd:annotation>
          <xsd:documentation xml:lang="en">A description of special aspects of the polymer type. monomer Ala 16 is a D-amino acid the oligomer contains alternating RNA and DNA units</xsd:documentation>
        </xsd:annotation>
      </xsd:element>
    </xsd:all>
    <xsd:attribute name="entity_id" use="required" type="xsd:string">
      <xsd:annotation>
        <xsd:documentation xml:lang="en">This data item is a pointer to attribute id in category entity in the ENTITY category.</xsd:documentation>
      </xsd:annotation>
    </xsd:attribute>
  </xsd:complexType>
</xsd:element>

Sample