PDBx:pdbx_prerelease_seqType

This category provides a placeholder for pre-release
sequence information.  After release this category
should be discarded.
<PDBx:pdbx_prerelease_seqCategory>
   <PDBx:pdbx_prerelease_seq entity_id="1">
      <PDBx:seq_one_letter_code>GKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD</PDBx:seq_one_letter_code>
   </PDBx:pdbx_prerelease_seq>
   <PDBx:pdbx_prerelease_seq entity_id="2">
      <PDBx:seq_one_letter_code>HKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNN</PDBx:seq_one_letter_code>
   </PDBx:pdbx_prerelease_seq>
</PDBx:pdbx_prerelease_seqCategory>

Complex Type Information

Model

Used By

Source

<xsd:complexType name="pdbx_prerelease_seqType">
  <xsd:annotation>
    <xsd:documentation xml:lang="en">This category provides a placeholder for pre-release sequence information. After release this category should be discarded. <PDBx:pdbx_prerelease_seqCategory> <PDBx:pdbx_prerelease_seq entity_id="1"> <PDBx:seq_one_letter_code>GKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD</PDBx:seq_one_letter_code> </PDBx:pdbx_prerelease_seq> <PDBx:pdbx_prerelease_seq entity_id="2"> <PDBx:seq_one_letter_code>HKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNN</PDBx:seq_one_letter_code> </PDBx:pdbx_prerelease_seq> </PDBx:pdbx_prerelease_seqCategory></xsd:documentation>
  </xsd:annotation>
  <xsd:sequence>
    <xsd:element name="pdbx_prerelease_seq" minOccurs="0" maxOccurs="unbounded">
      <xsd:complexType>
        <xsd:all>
          <xsd:element name="seq_one_letter_code" minOccurs="0" maxOccurs="1" nillable="true" type="xsd:string">
            <xsd:annotation>
              <xsd:documentation xml:lang="en">Chemical sequence expressed as string of one-letter amino acid codes. A for alanine or adenine B for ambiguous asparagine/aspartic-acid R for arginine N for asparagine D for aspartic-acid C for cysteine or cystine or cytosine Q for glutamine E for glutamic-acid Z for ambiguous glutamine/glutamic acid G for glycine or guanine H for histidine I for isoleucine L for leucine K for lysine M for methionine F for phenylalanine P for proline S for serine T for threonine or thymine W for tryptophan Y for tyrosine V for valine U for uracil MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD</xsd:documentation>
            </xsd:annotation>
          </xsd:element>
        </xsd:all>
        <xsd:attribute name="entity_id" use="required" type="xsd:string">
          <xsd:annotation>
            <xsd:documentation xml:lang="en">This data item is a pointer to attribute id in category entity in the ENTITY category.</xsd:documentation>
          </xsd:annotation>
        </xsd:attribute>
      </xsd:complexType>
    </xsd:element>
  </xsd:sequence>
</xsd:complexType>